Smp 194830

From Schistosome Wiki @ IBERS
Jump to navigation Jump to search

GeneDB ID:Smp_194830

Protein Name: SmKK7

Full Length clone: Yes


Full Length clone sequence

ATGAAGCTCTACTTCATTTTCTTTCTGTTGGTGATATACTGTGGATTTTACAGCG AAGCCAAACCTGGCCGAGTCAAGTGCAGCGCACAATGTTGGGAAACAGGAAT AAAGTGTAAGAATGACTGTAGAAACAATGCGTGTAAAAGAAATTGCCAAGATG GAGTTAGAGATTGTATACGTGAAGTATGCAAAGTAAGCGAGCACGTGGATACC TATGATGAACATAAATTGCATGACTAA

Primers used

SmKK7 FL F: GTAAACATTTGTCTGCAGGAGA (entirely 5' UTR)

SmKK& FL R: ATCACTTTCTCAGTACAACACA (entirely 3' UTR)

Vector

pGEMT-easy (Promega) Ampicillin resistance

Glycerol Stock

Box 1 R1C2

Microarray Profile

KK7.jpg

50mer - Contig34

Data obtained from Fitzpatrick et al., 2009

Protein Expression

Expression Vector - modified pET30a

Sequence modified/truncated - Yes (signal peptide removed)

Purification tag - 6XHis (c-terminal only)

Expressed protein sequence

MKPGRVKCSAQCWETGIKCKNDCRNNACKRNCQDGVRDCIREVCKVSEHVDTYDEHKLHDLEHHHHHH

Expressed protein MW/PI - 8.0kDa / 7.65

Literature

Originally identified in Curwen et al., 2006