Smp 176180

From Schistosome Wiki @ IBERS
Jump to navigation Jump to search

GeneDB ID: smp_176180

Protein Name: SmVAL9

Full Length clone: Yes


Full Length clone sequence

ATGTCTTTCAAATTTCACGTTTCTACAATCATATTTTTGACATGTTTTCTCCTATGCTCT TGTGTTCATGCAAAAATGAATGACACGATTCGTGAACAGTTATTAACAATGCACAATG TTGTAAGGGAACTTGCGAAGTTTGGTCTTATTCCTAGACAACCTGAAGCTGTGCACAT GAAACTACTGAAATGGAATATGGAATTGGAACGGAAAGCACAAAATTTATCCGATCAG TGTAAAAGTGAACATGATGAGATCGAACAACGGAGAATACCGGAATTTCAGAATGTTG GACAGACTTGGGTTGGTACTTATACAGTGGAAAGGGCTGTAAAATTATGGTTCAGCGA AGCCATGTATTATAACTTCAACACAAATATATGTAGTTCGGCTACGTGCGGAAATTATC CTCAGCTTGTTTGGGAAAATACTACCGATGTTGGTTGTGGTGTCACAGACTGCCCGAA TTTTAGAACCAAGCTCGTGATTGTGTGCAATTATGGTCCTGGAGGCAACATACCTGAACAAAGACCGTATAGGACTGCATAA

Primers used

SmVAL9_F: ATGTCTTTCAAATTTCACG

SmVAL9_R: TTATGCAGTCCTATACGGT

Annealing: 54 degrees Celsius

Polymerase: Phusion

Vector

?

Glycerol Stock

Box 1 R1C?

Microarray Lifecycle Profile

Smp 176180.jpg

50mer - CD111828

Data obtained from Fitzpatrick et al., 2009

Protein Expression

Expression Vector - modified pET30a

Sequence modified/truncated - Yes (Signal peptide removed)

Purification tag - 6XHis (c-terminal only)

Expressed protein sequence

MKMNDTIREQLLTMHNVVRELAKFGLIPRQPEAVHMKLLKWNMELERKA QNLSDQCKSEHDEIEQRRIPEFQNVGQTWVGTYTVERAVKLWFSEAMYYN FNTNICSSATCGNYPQLVWENTTDVGCGVTDCPNFRTKLVIVCNYGPGGNIPEQRPYRTALEHHHHHH

Expressed protein MW/PI - 19.5kDa / 6.75

Literature

Characterised in Chalmers et al., 2008

Proteomic identification in egg secretions in Cass et al., 2007

Proteomic identification in miracidia/sporocyst transformation secretions in Wu et al., 2009

Review of VAL homologs in Chalmers et al., 2012

MMP modulation effect of SmVAL9 in Yoshino et al., 2014