Smp 105220

From Schistosome Wiki @ IBERS
Jump to navigation Jump to search

GeneDB ID: smp_105220

Protein Name: SmLy6B

Full Length clone: Yes


Full Length clone sequence

ATGAAAGTATTGGGAATTTGTGTTATACTTACATTAATATTCAATGGAATAAA TTGTATAAAAAATAAGAAAGTCAAATGTTATCGATGTTCCGATTGTCCTAATC CATTCGATAAGACACAAATAACTGAATTAGGTAATTGTAACTTTTGTCGAACA GTTTACACTTATCGTGATGAAGATAATTATAGAATTGCGAAAGATTGTGTAGCA AGTTGTGTTCCACAAGATCGTCGTGGTGGTAAAGCTGGCTTAGTAACTGAATG TTGTGATGAAGATTATTGTAATGCATCACCTAAACATTATTCCATTTCATTTCTA TTAATTACTAGTTTTACAATTTTTATTACATATACTAATAAATTCATATATTGA

Primers used

SmLy6B FL F: ATGAAAGTATTGGGAATTTGTG

SmLy6B FL R: CGAGTTAACCGTTCAATATATGA (partially in 3' UTR)

Vector

pGEMT-easy (Promega) Ampicillin resistance

Glycerol Stock

Box 1 R1C4

Microarray Lifecycle Profile

Smp 105220.jpg

50mer - CL1286

Data obtained from Fitzpatrick et al., 2009

Protein Expression

Expression Vector - modified pET30a

Sequence modified/truncated - Yes (Signal peptide and C-terminal hydrophobic region removed)

Purification tag - 6XHis (c-terminal only)

Expressed protein sequence

MIKNKKVKCYRCSDCPNPFDKTQITELGNCNFCRTVYTYRDEDNYRIAKDCVASCVPQDR RGGKAGLVTECCDEDYCNASPKHLEHHHHHH

Expressed protein MW/PI - 10.6kDa / 7.56

Literature

Referred to as CD59b in Castro-Borges et al., 2011