Smp 019350

From Schistosome Wiki @ IBERS
Jump to navigation Jump to search

GeneDB ID: smp_019350

Protein Name: SmLy6A

Full Length clone: Yes


Full Length clone sequence

ATGATCTACAATTTCAATGTAATGATGTTACGTCTCTTCCCCATTCTACT TTTAGTGATTTTTACGTCAACAGGTTTAGGCCATCGTTGTTATGTGTGTA GTAAGTGTCAAGACCCATTCAGAGTTAAGGATACTGAAATACAAAATGGT TGTACCTTCTGTTCAACAATAAGAACATATGTTCAAGATAAACTACAAGT GACTAGTCGTAGTTGTGTTCCGGTTTGCGTTGAAGCTGATGCTAGGAGAT CCGGGTCAGGAATTGTTACATCGTGTTGTCAAGACGATTTATGCAATTCT GGTACACAAACACAAATATCCATGACTTTAATCCTATCTTCATTGTTTTC CATACTACCATTGTTATCACGTTACTTTTAA

Primers used

smp_019350_F: ATGATCTACAATTTCAATGTAATGATG

smp_019350_R: TTAAAAGTAACGTGATAACAATGGTA

Vector

pCR-Blunt (Zeroblunt - Invitrogen) Kanamycin resistance

Glycerol Stock

Box 1 R1C1

Microarray Lifecycle Profile

Smp 019350.jpg

50mer - Contig66

Data obtained from Fitzpatrick et al., 2009

Protein Expression

Expression Vector - modified pET30a

Sequence modified/truncated - Yes (Signal peptide and C-terminal hydrophobic region removed)

Purification tag - 6XHis (c-terminal only)

Expressed protein sequence

MHRCYVCSKCQDPFRVKDTEIQNGCTFCSTIRTYVQDKLQVTSRSCVPVCVEADARRSGS GIVTSCCQDDLCNSGTQTLEHHHHHH

Expressed protein MW/PI - 9.7kDa / 7.01

Literature

Referred to as SmCD59a in Castro-Borges et al., 2011

Characterised as SmCD59a in Farias et al., 2014