Sha 200489

From Schistosome Wiki @ IBERS
Jump to navigation Jump to search

S haematobium gene ID: Sha_200489

Protein Name: ShLy6B

Full Length clone: Yes


Full Length clone sequence

ATGAAAGTATTGGGAATTTGTATTGTAGTTACACTAATATTCAGT GGAATAAATTGTGTAAAAAATAAGAAAGTTAAATGTTATCGATGT ACCGATTGTCCTAATCCATTCGATAAAACTCAAATAACTGAATTA GCTAATTGTAATTTTTGTCGAACGGTTTACACTTATCGTGATGAA GATAATTATAGAATTGCAAAAGATTGTGTAGCAAGTTGTGTTCCA CAAGATCGTCGTGGTGGTAAAGCTGGCCTAGTAACTGAATGTTGT GATGAAGATTATTGTAATGCATCACCTAAACATTATTCTATTTCATTTTTATTAA

100% match to genome prediction

predicted protein sequence

MKVLGICIVVTLIFSGINCVKNKKVKCYRCTDCPNPFDKTQITELANCNFCRTVYTYRDE DNYRIAKDCVASCVPQDRRGGKAGLVTECCDEDYCNASPKHYSISFLL


Primers used

smp_019350_F: AAAACCCCAACAGAATTCATA (5' UTR)

smp_019350_R: TCGATAGAGAGAGAAGTAATGGTTC (3' UTR)

Cloned from adult worm cDNA

Vector

??

Glycerol Stock

Box 1 R1C?


Literature

Contributor

Kwaku Ahmed